PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0006s0120.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family TALE
Protein Properties Length: 447aa    MW: 50298.8 Da    PI: 6.5155
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0006s0120.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox29.31.4e-093894261954
                             HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
                Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                             Fe   ++yp+  e+  LA+++gLt++qV++WF N R +
  SapurV1A.0006s0120.2.p 389 FEHflHPYPNDFEKLMLASQTGLTKNQVSNWFINARVR 426
                             554459******************************88 PP

2BELL101.56.1e-33251322172
                    BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                             e++elq k+akL+ ll+eV+ rY++y++q++ ++ssFe+++glg+ak+Yt+l l+a+S+hF +L+dai++qi
  SapurV1A.0006s0120.2.p 251 EKHELQLKIAKLIALLKEVEGRYEKYYHQMEELVSSFEEITGLGAAKSYTTLSLQAMSKHFCNLRDAIVSQI 322
                             689********************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005748.0E-32182320IPR006563POX domain
PfamPF075264.7E-37188319IPR006563POX domain
PROSITE profilePS5007111.661367430IPR001356Homeobox domain
CDDcd000867.32E-11370431No hitNo description
SMARTSM003891.7E-9370434IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.0E-26375436IPR009057Homeodomain-like
SuperFamilySSF466891.03E-17375437IPR009057Homeodomain-like
PfamPF059201.6E-16387426IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 447 aa     Download sequence    Send to blast
MGSQDSPPNS ASGMLHQFII SDSIASQNQF QCQNFNIFGP DLRGSNTFSQ SNGVLPSIKS  60
LEERMSRSID LVQVPSAVQE SEISHTRHLM DLLGAANETN HQAQRLSLSL GSQMLVPQVQ  120
YRQRSFNSDL MSPNYLIPRV EEREAYYLGG EQANDDYSLT DSGFPQSSTS SSRPSSTSYG  180
TESLAVAIGN SRYLKPAQSL LEEIVHVSCK AVEISNEKCV GKLFPCGQRG SLGLSSELKV  240
ELWGIGLVQA EKHELQLKIA KLIALLKEVE GRYEKYYHQM EELVSSFEEI TGLGAAKSYT  300
TLSLQAMSKH FCNLRDAIVS QINETKIKFS RDLPKISTGL SQLNLFDKEN RHSRISLQQL  360
GMMQSQRQTW RPIRGLPETS VAILRSWLFE HFLHPYPNDF EKLMLASQTG LTKNQVSNWF  420
INARVRLWKP MIEEMYKEEF ADHSED*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_A5e-16376434563Homeobox protein Meis2
3k2a_B5e-16376434563Homeobox protein Meis2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002302013.10.0homeodomain-containing family protein
SwissprotQ1PFD11e-101BLH11_ARATH; BEL1-like homeodomain protein 11
TrEMBLB9GRJ00.0B9GRJ0_POPTR; Homeodomain-containing family protein
STRINGPOPTR_0002s03230.10.0(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G75430.11e-95BEL1-like homeodomain 11